PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna05581.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 364aa    MW: 40642.4 Da    PI: 7.8324
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna05581.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.9e-161462148
                             TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                             +g+W++eEd +l+ ++ ++G+g +W + ++++g++R++k+c++rw++yl
  mrna05581.1-v1.0-hybrid 14 KGPWSPEEDAKLKSYIDKHGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                             79*********************************************97 PP

2Myb_DNA-binding384e-1269111246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              g +++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
  mrna05581.1-v1.0-hybrid  69 GGFSEEEDNIICSLYINIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                              569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.188962IPR017930Myb domain
SuperFamilySSF466893.22E-2612109IPR009057Homeodomain-like
SMARTSM007172.5E-121364IPR001005SANT/Myb domain
PfamPF002491.5E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-251569IPR009057Homeodomain-like
CDDcd001671.57E-91662No hitNo description
PROSITE profilePS5129421.41163117IPR017930Myb domain
SMARTSM007179.9E-1167115IPR001005SANT/Myb domain
PfamPF002499.4E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2370117IPR009057Homeodomain-like
CDDcd001675.84E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MGRAPCCDKT KVKKGPWSPE EDAKLKSYID KHGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC SLYINIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGK  120
QRKEHQAQNR RAAASLKQEI KRSSTTTTNF HLPPDGFVNN QVNPYWAPEL PVLPVMSYQT  180
HDAQVLDDHQ ASIKNMLIKL GGRFSDTTSS MYPPIDHISS TSSDQFYQNS SIDHLLTTCS  240
PVANTNYAQL GPSPSPTMFH GVDHQSDLEA ELSELVYGNS QLPHQQYDGL AGFYQMETLN  300
NGSTGGTTST SAESEISWGD INSLVYSTTT PMVSDYENSC QQVVRPSDSA FAESNYFAMK  360
YQR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-25141177108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00089SELEXTransfer from AT3G49690Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004288285.10.0PREDICTED: transcription factor RAX3
TrEMBLM5WKM31e-147M5WKM3_PRUPE; Uncharacterized protein
STRINGPOPTR_0007s14630.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.13e-83myb domain protein 84